PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi11g11430.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family G2-like
Protein Properties Length: 284aa    MW: 31834.7 Da    PI: 7.0678
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi11g11430.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like69.26.4e-22166210145
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtleh 45 
                      k+r++W+peLH+rFv+a+e+LGGs+ AtPk+i+elm v+gLt+++
  Vradi11g11430.1 166 KQRRCWSPELHHRFVKALEELGGSQAATPKQIRELMRVDGLTNDE 210
                      79****************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.09E-9164217IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.9E-18165218IPR009057Homeodomain-like
TIGRFAMsTIGR015575.2E-16166210IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MVAAISALKE ELAKCRALKS EPVLEEFIPL KREYEEKEDS EKEEECRDKN DWVSSFQLWN  60
TEDEACNRSK ACRLEQKQKK SKGEERKSVE KDYFRHHSNR NVERGFVMPL STYLATEEEC  120
VMDGLSLKTP ATAVKNTREG RGSRISSCRV VSSATSPMLL PQSGRKQRRC WSPELHHRFV  180
KALEELGGSQ AATPKQIREL MRVDGLTNDE KYRLHTRRVP AATAANSSIS GADLGGLWMH  240
KESMKGTSSC SPQGPLQFAT QSGETTSTTE GDNMIDDDVK SDL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150431e-162AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014519321.10.0PREDICTED: uncharacterized protein LOC106776390 isoform X1
TrEMBLA0A0L9UUK30.0A0A0L9UUK3_PHAAN; Uncharacterized protein
STRINGGLYMA07G29490.11e-138(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.12e-32G2-like family protein